AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RTP4 Antibody
상품 한눈에 보기
인간 RTP4 단백질에 대한 고특이성 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. Rabbit 유래 IgG 항체이며 PrEST 항원으로 친화 정제되었습니다. 다양한 종에서 교차 반응성이 검증된 고품질 연구용 시약입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA071189-100 Anti-RTP4 Antibody, receptor (chemosensory) transporter protein 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071189-25 Anti-RTP4 Antibody, receptor (chemosensory) transporter protein 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RTP4 Antibody
Anti-RTP4 Antibody
Target Information
- Target Protein: receptor (chemosensory) transporter protein 4
- Target Gene: RTP4
- Alternative Gene Names: IFRG28, Z3CXXC4
Product Description
Polyclonal antibody against human RTP4.
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
CSWSQYEMPEFSSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEACTLGICG
Species Reactivity
| Species | Identity (%) | Gene ID |
|---|---|---|
| Human | 100 | - |
| Rat | 48 | ENSRNOG00000028895 |
| Mouse | 46 | ENSMUSG00000066319 |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| Component | Description |
|---|---|
| Buffer | PBS (pH 7.2) with 40% glycerol |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.