CacheBy
Atlas Antibodies Anti-RTN4IP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RTN4IP1 Antibody

상품 한눈에 보기

Human RTN4IP1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합. PrEST 항원을 이용해 친화 정제됨. NIMP 유전자 대체명으로 알려진 RTN4IP1 단백질 연구에 유용. 글리세롤 및 PBS 완충액에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA036357-100 Anti-RTN4IP1 Antibody, reticulon 4 interacting protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036357-25 Anti-RTN4IP1 Antibody, reticulon 4 interacting protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RTN4IP1 Antibody

Anti-RTN4IP1 Antibody

Target: Reticulon 4 Interacting Protein 1 (RTN4IP1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human RTN4IP1.


Alternative Gene Names

  • NIMP

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Reticulon 4 Interacting Protein 1
Target Gene RTN4IP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence TLVTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCLDDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGK

Species Reactivity

  • Verified: Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000019864 (91%)
  • Rat ENSRNOG00000000279 (91%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.