CacheBy
Atlas Antibodies Anti-RTP5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RTP5 Antibody

상품 한눈에 보기

Human RTP5 단백질을 표적으로 하는 폴리클로날 항체. Rabbit 호스트에서 생산되었으며 IgG 아이소타입. IHC 등 다양한 연구 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA050902-100 Anti-RTP5 Antibody, receptor (chemosensory) transporter protein 5 (putative) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050902-25 Anti-RTP5 Antibody, receptor (chemosensory) transporter protein 5 (putative) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RTP5 Antibody

Anti-RTP5 Antibody

Target: receptor (chemosensory) transporter protein 5 (putative)

면역조직화학 (IHC)

Product Description

Polyclonal antibody against Human RTP5.

Alternative Gene Names

C2orf85, CXXC11, FLJ33590, Z3CXXC5

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein receptor (chemosensory) transporter protein 5 (putative)
Target Gene RTP5
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000006460 (26%), Mouse ENSMUSG00000038256 (23%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PSSLTSIFTNTLSEPTDGPVATKEASITFPFIFTDVKDAVAEVAEGNGKEGGGQGLVPVGHDALPETNAGGLPSQVKGSLALPFPADVQGKDAFTD

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.