Atlas Antibodies Anti-RSG1 Antibody

상품 한눈에 보기

Human RSG1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit에서 생산된 IgG 형식이며, PrEST 항원을 이용해 친화 정제되었습니다. Recombinant expression validation으로 신뢰성 검증 완료.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028453-100 Anti-RSG1 Antibody, REM2 and RAB-like small GTPase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028453-25 Anti-RSG1 Antibody, REM2 and RAB-like small GTPase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-RSG1 Antibody

Anti-RSG1 Antibody

Target Information

Target Protein: REM2 and RAB-like small GTPase 1
Target Gene: RSG1
Alternative Gene Names: C1orf89, MGC10731

Product Description

Polyclonal Antibody against Human RSG1.

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB, recombinant expression validation)
Immunocytochemistry (ICC)

Recombinant expression validation: WB 검증 시 target protein 과발현을 이용하여 수행됨.

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence:
KFDQYMHTDVPERDLTAFRQAWELPLLRVKSVPGRRLADGRTLDGRAGLADVAHILNGLAEQLWHQDQVAAGLLPNPPESAPE

Verified Species Reactivity

Human

Interspecies Information

Species	Ortholog ID	Sequence Identity
Rat	ENSRNOG00000023346	92%
Mouse	ENSMUSG00000073733	92%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand