
Atlas Antibodies Anti-RSL24D1 Antibody
인간 RSL24D1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 실험에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대해 검증되었으며, 마우스 및 랫트와 높은 상동성을 가집니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RSL24D1 Antibody
Target: ribosomal L24 domain containing 1 (RSL24D1)
Supplier: Atlas Antibodies
Recommended Applications
IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human RSL24D1.
Alternative Gene Names
C15orf15, HRP-L30-iso, L30, RPL24, RPL24L
Antigen and Reactivity Information
| 항목 | 내용 |
|---|---|
| Target Protein | ribosomal L24 domain containing 1 |
| Target Gene | RSL24D1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | QRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIH |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000032215 (100%), Rat ENSRNOG00000052787 (98%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RSPH1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RSPH3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RSL24D1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RSPH1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RSG1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|