Atlas Antibodies Anti-RSL24D1 Antibody

상품 한눈에 보기

Human RSL24D1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. 독립 항체 간 비교로 검증된 신뢰도 높은 제품이며, PrEST 항원을 이용해 친화 정제되었습니다. 40% glycerol 기반 PBS buffer에 보존되어 있습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA062724-100 Anti-RSL24D1 Antibody, ribosomal L24 domain containing 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA062724-25 Anti-RSL24D1 Antibody, ribosomal L24 domain containing 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-RSL24D1 Antibody

Anti-RSL24D1 Antibody

Target: ribosomal L24 domain containing 1 (RSL24D1)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC: Suitable for immunocytochemistry.

Product Description

Polyclonal antibody against Human RSL24D1.

Alternative Gene Names

C15orf15, HRP-L30-iso, L30, RPL24, RPL24L

Target Information

항목	내용
Target Protein	ribosomal L24 domain containing 1
Target Gene	RSL24D1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	QRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIH
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000032215 (100%), Rat ENSRNOG00000052787 (98%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)