CacheBy
Atlas Antibodies Anti-RSL24D1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RSL24D1 Antibody

상품 한눈에 보기

Human RSL24D1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. 독립 항체 간 비교로 검증된 신뢰도 높은 제품이며, PrEST 항원을 이용해 친화 정제되었습니다. 40% glycerol 기반 PBS buffer에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA062724-100 Anti-RSL24D1 Antibody, ribosomal L24 domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062724-25 Anti-RSL24D1 Antibody, ribosomal L24 domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RSL24D1 Antibody

Anti-RSL24D1 Antibody

Target: ribosomal L24 domain containing 1 (RSL24D1)
Supplier: Atlas Antibodies


  • IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC: Suitable for immunocytochemistry.

Product Description

Polyclonal antibody against Human RSL24D1.


Alternative Gene Names

C15orf15, HRP-L30-iso, L30, RPL24, RPL24L


Target Information

항목 내용
Target Protein ribosomal L24 domain containing 1
Target Gene RSL24D1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence QRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIH
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000032215 (100%), Rat ENSRNOG00000052787 (98%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Validation
WB Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.