Thermo Fisher Scientific GNAQ Polyclonal Antibody
GNAQ 단백질을 인식하는 Rabbit Polyclonal 항체로 Western blot, IHC, ICC, Flow cytometry에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific GNAQ Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (IHC) | – | View 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | – |
| Immunocytochemistry (ICC/IF) | 2 µg/mL | – |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells | – |
Product Specifications
| Item | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to N-terminus of human GNAQ (102–138 aa: KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746434 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Guanine nucleotide-binding proteins are heterotrimeric proteins that couple cell surface, seven-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GTP for GDP on the inactive G protein alpha subunit, causing conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits regulate various cellular effectors. Activation is terminated by intrinsic GTPase activity of the G-alpha subunit. G-alpha-q mediates stimulation of phospholipase C-beta.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.