Thermo Fisher Scientific GREM1 Polyclonal Antibody
GREM1 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot에 적합합니다. Human 및 Rat 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도로 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific GREM1 Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Gremlin 1 (151–184aa, TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746440 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
In Xenopus, Gremlin belongs to a novel gene family that acts as BMP antagonists in embryonic explants.
The human homolog of Drm/Gremlin (CKTFS1B1) is localized on human chromosome 15q13→q15.
DRM-specific mRNA is expressed in human tissues including brain, ovary, intestine, and colon.
Down-regulation of DRM has been associated with tumor progression, suggesting its role in neuroembryological development and carcinogenesis.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.