Thermo Fisher Scientific GREM1 Polyclonal Antibody
GREM1 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot에 적합합니다. Human 및 Rat 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도로 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Gremlin 1 (151–184aa, TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746440 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
In Xenopus, Gremlin belongs to a novel gene family that acts as BMP antagonists in embryonic explants.
The human homolog of Drm/Gremlin (CKTFS1B1) is localized on human chromosome 15q13→q15.
DRM-specific mRNA is expressed in human tissues including brain, ovary, intestine, and colon.
Down-regulation of DRM has been associated with tumor progression, suggesting its role in neuroembryological development and carcinogenesis.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific GluR4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GRB7 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GREM1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GNAQ Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific RACK1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|