Thermo Fisher Scientific BMP4 Recombinant Rabbit Monoclonal Antibody (ARC0587)
BMP4 단백질을 인식하는 토끼 유래 재조합 단클론 항체로, Western blot, IHC, ICC, ELISA 등 다양한 응용에 적합합니다. HEK293 세포에서 발현되며, 높은 특이성과 재현성을 제공합니다. 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:1,000–1:6,000 |
| Immunohistochemistry (Paraffin) (IHC-P) | 1:200–1:800 |
| Immunocytochemistry (ICC/IF) | 1:50–1:500 |
| ELISA | 1 µg/mL |
Product Specifications
| Specification | Detail |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Expression System | HEK293 cells |
| Class | Recombinant Monoclonal |
| Type | Antibody |
| Clone | ARC0587 |
| Immunogen | Synthetic peptide corresponding to amino acids 309–408 of human BMP4 (UniProt ID: P12644) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol, 0.05% BSA |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, avoid freeze/thaw cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2849010 |
Product Specific Information
Immunogen sequence:
RRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Target Information
The BMP4 gene encodes a member of the bone morphogenetic protein family, part of the TGF-beta superfamily, which includes growth and differentiation factors. Bone morphogenetic proteins were first identified for their ability to induce endochondral osteogenesis in vivo. BMP4 plays a critical role in the onset of endochondral bone formation in humans. Reduced expression of BMP4 has been associated with bone disorders such as Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5′ untranslated region results in three transcript variants encoding the same protein.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Mast Cell Chymase Recombinant Rabbit Monoclonal Antibody (ARC0614)
598,300원
Thermo Fisher Scientific
Thermo Fisher Scientific MAD2 Recombinant Rabbit Monoclonal Antibody (ARC0603)
598,300원
Thermo Fisher Scientific
Thermo Fisher Scientific BMP4 Recombinant Rabbit Monoclonal Antibody (ARC0587)
598,300원
Thermo Fisher Scientific
Thermo Fisher Scientific ATOH1 Recombinant Rabbit Monoclonal Antibody (ARC0609)
598,300원
Thermo Fisher Scientific
Thermo Fisher Scientific CES1 Recombinant Rabbit Monoclonal Antibody (ARC0613)
598,300원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|