
Thermo Fisher Scientific BMP4 Recombinant Rabbit Monoclonal Antibody (ARC0587)
BMP4 단백질을 인식하는 토끼 유래 재조합 단클론 항체로, Western blot, IHC, ICC, ELISA 등 다양한 응용에 적합합니다. HEK293 세포에서 발현되며, 높은 특이성과 재현성을 제공합니다. 연구용으로만 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific BMP4 Recombinant Rabbit Monoclonal Antibody (ARC0587)
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:1,000–1:6,000 |
| Immunohistochemistry (Paraffin) (IHC-P) | 1:200–1:800 |
| Immunocytochemistry (ICC/IF) | 1:50–1:500 |
| ELISA | 1 µg/mL |
Product Specifications
| Specification | Detail |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Expression System | HEK293 cells |
| Class | Recombinant Monoclonal |
| Type | Antibody |
| Clone | ARC0587 |
| Immunogen | Synthetic peptide corresponding to amino acids 309–408 of human BMP4 (UniProt ID: P12644) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol, 0.05% BSA |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, avoid freeze/thaw cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2849010 |
Product Specific Information
Immunogen sequence:
RRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Target Information
The BMP4 gene encodes a member of the bone morphogenetic protein family, part of the TGF-beta superfamily, which includes growth and differentiation factors. Bone morphogenetic proteins were first identified for their ability to induce endochondral osteogenesis in vivo. BMP4 plays a critical role in the onset of endochondral bone formation in humans. Reduced expression of BMP4 has been associated with bone disorders such as Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5′ untranslated region results in three transcript variants encoding the same protein.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
