
Atlas Antibodies Anti-CSTF3 Antibody
상품 한눈에 보기
Human CSTF3 단백질을 인식하는 토끼 폴리클로날 항체로 IHC, WB, ICC에 적합. 독립 항체 검증을 통해 높은 특이성과 재현성 확보. 프레스티지 정제 방식으로 높은 순도 제공. Human 및 Mouse 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CSTF3 Antibody
cleavage stimulation factor, 3′ pre-RNA, subunit 3, 77 kDa
Recommended Applications
- IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human CSTF3.
Alternative Gene Names
- CstF-77
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cleavage stimulation factor, 3′ pre-RNA, subunit 3, 77 kDa |
| Target Gene | CSTF3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LAFESNIGDLASILKVEKRRFTAFKEEYEGKETALLVDRYKFMDLYPCSASELKALGYKDVSRAKLAAIIPDPVVAPSIVPVLKDEVDRKPEYPKPDTQQMIPF |
Species Reactivity
- Verified: Human, Mouse
- Interspecies Identity:
- Mouse ENSMUSG00000027176 (99%)
- Rat ENSRNOG00000012089 (99%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CT45A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CSTF3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CSTF3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CSTF2T Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CSTF2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.