
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CSTF3 Antibody
상품 한눈에 보기
Human CSTF3 단백질을 인식하는 토끼 폴리클로날 항체로 IHC, WB, ICC에 적합. 독립 항체 검증을 통해 높은 특이성과 재현성 확보. 프레스티지 정제 방식으로 높은 순도 제공. Human 및 Mouse 반응성 검증 완료.
- 카탈로그번호
- HPA040168-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA040168-100 Anti-CSTF3 Antibody, cleavage stimulation factor, 3` pre-RNA, subunit 3, 77kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040168-25 Anti-CSTF3 Antibody, cleavage stimulation factor, 3` pre-RNA, subunit 3, 77kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CSTF3 Antibody
Anti-CSTF3 Antibody
cleavage stimulation factor, 3′ pre-RNA, subunit 3, 77 kDa
Recommended Applications
- IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human CSTF3.
Alternative Gene Names
- CstF-77
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cleavage stimulation factor, 3′ pre-RNA, subunit 3, 77 kDa |
| Target Gene | CSTF3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LAFESNIGDLASILKVEKRRFTAFKEEYEGKETALLVDRYKFMDLYPCSASELKALGYKDVSRAKLAAIIPDPVVAPSIVPVLKDEVDRKPEYPKPDTQQMIPF |
Species Reactivity
- Verified: Human, Mouse
- Interspecies Identity:
- Mouse ENSMUSG00000027176 (99%)
- Rat ENSRNOG00000012089 (99%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



