Atlas Antibodies Anti-CT45A1 Antibody

상품 한눈에 보기

Human CT45A1 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB를 통한 오쏘고날 검증 수행. Rabbit 유래 IgG, PrEST 항원으로 정제됨. 암/고환 항원 연구 및 단백질 발현 분석에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA044757-100 Anti-CT45A1 Antibody, cancer/testis antigen family 45, member A1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA044757-25 Anti-CT45A1 Antibody, cancer/testis antigen family 45, member A1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: cancer/testis antigen family 45, member A1
Supplier: Atlas Antibodies

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human CT45A1

CT45-1, CT45.1

항목	내용
Target Protein	cancer/testis antigen family 45, member A1
Target Gene	CT45A1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	TEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSK
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000035161 (30%), Rat ENSRNOG00000009873 (30%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand