CacheBy
Atlas Antibodies Anti-CSTF3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CSTF3 Antibody

상품 한눈에 보기

Human CSTF3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 검증으로 높은 신뢰성 확보. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039743-100 Anti-CSTF3 Antibody, cleavage stimulation factor, 3` pre-RNA, subunit 3, 77kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039743-25 Anti-CSTF3 Antibody, cleavage stimulation factor, 3` pre-RNA, subunit 3, 77kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CSTF3 Antibody

Anti-CSTF3 Antibody

cleavage stimulation factor, 3′ pre-RNA, subunit 3, 77 kDa


  • IHC (Immunohistochemistry)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human CSTF3


Alternative Gene Names

  • CstF-77

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein cleavage stimulation factor, 3′ pre-RNA, subunit 3, 77 kDa
Target Gene CSTF3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LAFESNIGDLASILKVEKRRFTAFKEEYEGKETALLVDRYKFMDLYPCSASELKALGYKDVSRAKLAAIIPDPVVAPSIVPVLKDEVDRKPEYPKPDTQQMIPF

Verified Species Reactivity

  • Human
  • Mouse

Interspecies Information
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000012089 (99%)
  • Mouse ENSMUSG00000027176 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.