
Atlas Antibodies Anti-CSN3 Antibody
상품 한눈에 보기
인간 CSN3(casein kappa)를 인식하는 폴리클로날 항체로, IHC 검증을 통해 단백질 발현 확인에 적합합니다. Rabbit IgG 기반이며 PrEST 항원으로 정제되었습니다. 인체 반응성이 검증된 고품질 연구용 항체입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CSN3 Antibody
Target Protein: casein kappa
Product Type: Polyclonal Antibody against Human CSN3
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against human CSN3 (casein kappa). The antibody is affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
- CSN10
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | casein kappa |
| Target Gene | CSN3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000001951 (40%), Mouse ENSMUSG00000001622 (34%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
PAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPPKKIQDKIIIPTINTIATVEPTPA제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CSNK1E Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CSNK1A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CSN3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CSN2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CSN3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.