Atlas Antibodies Anti-CSNK1E Antibody

상품 한눈에 보기

Human CSNK1E 단백질을 인식하는 Rabbit Polyclonal 항체로, Western Blot 등 다양한 응용에 적합. CKIE, CKIepsilon 등 대체 유전자명으로도 알려짐. 고순도 Affinity Purification 방식으로 제조되어 높은 특이성과 재현성을 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA026288-100 Anti-CSNK1E Antibody, casein kinase 1 epsilon 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA026288-25 Anti-CSNK1E Antibody, casein kinase 1 epsilon 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CSNK1E Antibody

Anti-CSNK1E Antibody

Target Information

Target Protein: casein kinase 1 epsilon
Target Gene: CSNK1E
Alternative Gene Names: CKIE, CKIepsilon, HCKIE

Product Description

Polyclonal antibody against human CSNK1E (casein kinase 1 epsilon).
Produced in rabbit and purified using the PrEST antigen as affinity ligand.

Recommended Applications

Western Blot (WB)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAGNTSP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to orthologs:

Rat ENSRNOG00000013076 (99%)
Mouse ENSMUSG00000022433 (97%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen
Storage Notes	Gently mix before use. Determine optimal concentration and conditions experimentally.