
Atlas Antibodies Anti-CSN3 Antibody
상품 한눈에 보기
Human CSN3(casein kappa)를 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합. Rabbit 유래 IgG이며 PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며 글리세롤/PBS 버퍼에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CSN3 Antibody
Target Information
- Target Protein: casein kappa
- Target Gene: CSN3
- Alternative Gene Names: CSN10
Product Description
Polyclonal Antibody against Human CSN3 (casein kappa).
Validated for protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
PAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPPKKIQDKIIIPTINTIATVEPTPA
Species Reactivity
- Verified Species: Human
- Interspecies Information:
- Rat ENSRNOG00000001951 (40%)
- Mouse ENSMUSG00000001622 (34%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Open Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
