
Atlas Antibodies Anti-CRYZL1 Antibody
상품 한눈에 보기
Human CRYZL1 단백질에 특이적인 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. Recombinant expression validation으로 검증되었으며, Rabbit에서 생산된 IgG 항체입니다. PrEST 항원을 이용해 친화 정제된 고품질 연구용 시약입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CRYZL1 Antibody
crystallin, zeta (quinone reductase)-like 1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Recombinant expression validation using target protein overexpression
Product Description
Polyclonal Antibody against Human CRYZL1
Alternative Gene Names
- 4P11
- QOH-1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | crystallin, zeta (quinone reductase)-like 1 |
| Target Gene | CRYZL1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKLQVKACALSQINTKLLAEMKMKKDLFPVGREIAGIVLD |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000028014 (83%), Mouse ENSMUSG00000058240 (83%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative). Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CSAG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CRYZ Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CRYZL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CRYZL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CRYM Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.