Atlas Antibodies Anti-CRYM Antibody

상품 한눈에 보기

Human CRYM 단백질을 표적으로 하는 폴리클로날 토끼 항체로, IHC 및 RNA-seq 데이터 비교를 통한 Orthogonal 검증 완료. PrEST 항원으로 친화 정제되었으며, 고순도 IgG 형태로 제공. 인체 반응성이 확인되어 연구용으로 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030619-100 Anti-CRYM Antibody, crystallin, mu 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030619-25 Anti-CRYM Antibody, crystallin, mu 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: crystallin, mu
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human CRYM

DFNA40

항목	내용
Target Protein	crystallin, mu
Target Gene	CRYM
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	DDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet