CacheBy
Atlas Antibodies Anti-CRYZ Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CRYZ Antibody

상품 한눈에 보기

Human CRYZ 단백질에 특이적인 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Rabbit 유래 IgG 항체이며 PrEST 항원으로 정제됨. 인간 반응성이 검증되었으며, 높은 종간 항원 서열 유사성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023290-100 Anti-CRYZ Antibody, crystallin, zeta (quinone reductase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023290-25 Anti-CRYZ Antibody, crystallin, zeta (quinone reductase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CRYZ Antibody

Anti-CRYZ Antibody

crystallin, zeta (quinone reductase)


  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Independent validation comparing antibodies targeting different epitopes
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human CRYZ

Open Datasheet


Target Information

항목 내용
Target Protein crystallin, zeta (quinone reductase)
Target Gene CRYZ
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence HGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGA
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000028199 (80%), Rat ENSRNOG00000028319 (80%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.