
Thermo Fisher Scientific VASP Polyclonal Antibody
VASP 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, WB, IHC, ICC, Flow Cytometry 등 다양한 응용에 적합. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 고순도 항체로 세포 부착 및 이동 연구에 활용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminus of human VASP (78–114 aa: NFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747326 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Vasodilator-stimulated phosphoprotein (VASP) is a member of the Ena-VASP protein family. These proteins contain:
- An EHV1 N-terminal domain that binds proteins with E/DFPPPPXD/E motifs, targeting Ena-VASP to focal adhesions.
- A proline-rich mid-region binding SH3 and WW domain-containing proteins.
- A C-terminal EVH2 domain mediating tetramerization and binding both G and F actin.
VASP is associated with filamentous actin formation and plays a role in cell adhesion and motility. It may also participate in intracellular signaling pathways regulating integrin–extracellular matrix interactions. VASP activity is regulated by cyclic nucleotide-dependent kinases PKA and PKG.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-80212_VASP_P50552-1_Rabbit.svg, PA5-80212_VASP_P50552-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific VAPB Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific VCAM-1 (CD106) Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific VASP Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific VCAM-1 (CD106) Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ULK3 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|