CacheBy
Thermo Fisher Scientific VASP Polyclonal Antibody
원본

Thermo Fisher Scientific VASP Polyclonal Antibody

상품 한눈에 보기

VASP 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, WB, IHC, ICC, Flow Cytometry 등 다양한 응용에 적합. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 고순도 항체로 세포 부착 및 이동 연구에 활용 가능.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 31. 오후 12:39
Thermo Fisher Scientific PA580212 VASP Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific VASP Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC-P) 0.5–1 µg/mL
Immunohistochemistry (Frozen) (IHC-F) 0.5–1 µg/mL
Immunocytochemistry (ICC/IF) 0.5–1 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

Specification Description
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide corresponding to a sequence at the N-terminus of human VASP (78–114 aa: NFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALE)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2747326

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Vasodilator-stimulated phosphoprotein (VASP) is a member of the Ena-VASP protein family. These proteins contain:

  • An EHV1 N-terminal domain that binds proteins with E/DFPPPPXD/E motifs, targeting Ena-VASP to focal adhesions.
  • A proline-rich mid-region binding SH3 and WW domain-containing proteins.
  • A C-terminal EVH2 domain mediating tetramerization and binding both G and F actin.

VASP is associated with filamentous actin formation and plays a role in cell adhesion and motility. It may also participate in intracellular signaling pathways regulating integrin–extracellular matrix interactions. VASP activity is regulated by cyclic nucleotide-dependent kinases PKA and PKG.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 파일: PA5-80212_VASP_P50552-1_Rabbit.svg, PA5-80212_VASP_P50552-1_Rabbit_PDP.jpeg)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.