Thermo Fisher Scientific SUR1 Polyclonal Antibody
SUR1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, WB, IHC(F), ICC/IF, Flow Cytometry에 사용 가능. 고순도 항원 친화 크로마토그래피 정제. 인간, 마우스, 랫트 반응성. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific SUR1 Polyclonal Antibody
Thermo Fisher Scientific SUR1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human SUR1 sequence (TIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKA) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2745812 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The protein encoded by this gene belongs to the ATP-binding cassette (ABC) transporter superfamily. ABC proteins transport various molecules across extra- and intra-cellular membranes and are divided into seven distinct subfamilies. This protein is part of the MRP subfamily, involved in multidrug resistance. It modulates ATP-sensitive potassium channels and insulin release. Mutations in this protein are linked to hyperinsulinemic hypoglycemia of infancy and type II diabetes mellitus. Alternative splicing has been observed but not fully characterized.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-78696_SUR1_Q09428-1_Rabbit.svg, PA5-78696_SUR1_Q09428-1_Rabbit_PDP.jpeg)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.