CacheBy
Atlas Antibodies Anti-QPCT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-QPCT Antibody

상품 한눈에 보기

인간 QPCT 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. 재조합 발현 및 RNA-seq 비교를 통한 정교한 검증 수행. 토끼 유래 IgG 항체이며, 친화성 정제 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008406-100 Anti-QPCT Antibody, glutaminyl-peptide cyclotransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008406-25 Anti-QPCT Antibody, glutaminyl-peptide cyclotransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-QPCT Antibody

Anti-QPCT Antibody

Target: Glutaminyl-peptide cyclotransferase (QPCT)
Type: Polyclonal antibody against human QPCT
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Recombinant expression): Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody against human QPCT.

Alternative Gene Names: GCT, QC
Target Protein: Glutaminyl-peptide cyclotransferase
Target Gene: QPCT
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

VPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDH

Open Datasheet


Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000024084 84%
Rat ENSRNOG00000005705 84%

Antibody Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.