
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-QPCT Antibody
상품 한눈에 보기
인간 QPCT 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. 재조합 발현 및 RNA-seq 비교를 통한 정교한 검증 수행. 토끼 유래 IgG 항체이며, 친화성 정제 방식으로 높은 특이성과 재현성을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA008406-100 Anti-QPCT Antibody, glutaminyl-peptide cyclotransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008406-25 Anti-QPCT Antibody, glutaminyl-peptide cyclotransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-QPCT Antibody
Anti-QPCT Antibody
Target: Glutaminyl-peptide cyclotransferase (QPCT)
Type: Polyclonal antibody against human QPCT
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Recombinant expression): Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human QPCT.
Alternative Gene Names: GCT, QC
Target Protein: Glutaminyl-peptide cyclotransferase
Target Gene: QPCT
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDH
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000024084 | 84% |
| Rat | ENSRNOG00000005705 | 84% |
Antibody Specifications
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



