CacheBy
Atlas Antibodies Anti-QPRT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-QPRT Antibody

상품 한눈에 보기

Human QPRT 단백질을 인식하는 Rabbit Polyclonal 항체로, WB Orthogonal validation 완료. Affinity purification 방식으로 높은 특이성과 재현성을 제공하며, 40% glycerol 기반 안정화 버퍼에 보관. 연구용으로 QPRT 발현 분석에 적합.

카탈로그번호
HPA076010-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA076010-100 Anti-QPRT Antibody, quinolinate phosphoribosyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076010-25 Anti-QPRT Antibody, quinolinate phosphoribosyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-QPRT Antibody

Anti-QPRT Antibody

Target: quinolinate phosphoribosyltransferase (QPRT)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human QPRT


Alternative Gene Names

  • QPRTase

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein quinolinate phosphoribosyltransferase
Target Gene QPRT
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence ALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGVLAGQPFFDAIFTQLNCQVSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAAAVEAARGAGWTGHVAGTRKTTPGFRLV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000030674 (86%)
  • Rat ENSRNOG00000016980 (84%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.