CacheBy
Atlas Antibodies Anti-QPRT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-QPRT Antibody

상품 한눈에 보기

Human QPRT 단백질을 인식하는 토끼 폴리클로날 항체로, WB 검증을 통해 RNA-seq 데이터와 비교한 정교한 발현 검증 제공. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 확보. 인체 QPRTase 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011887-100 Anti-QPRT Antibody, quinolinate phosphoribosyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011887-25 Anti-QPRT Antibody, quinolinate phosphoribosyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-QPRT Antibody

Anti-QPRT Antibody

Target: quinolinate phosphoribosyltransferase (QPRT)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using Western Blot (WB) by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human QPRT.


Alternative Gene Names

  • QPRTase

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein quinolinate phosphoribosyltransferase
Target Gene QPRT
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence ALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGVLAGQPFFDAIFTQLNCQVSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAAAVEAARGAGWTGHVAGTRKTTPGFRLV

Species Reactivity

  • Verified Species: Human
  • Interspecies Information:
    • Mouse ENSMUSG00000030674 (86%)
    • Rat ENSRNOG00000016980 (84%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.