CacheBy
Atlas Antibodies Anti-PTCD3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTCD3 Antibody

상품 한눈에 보기

인간 PTCD3 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit에서 생산되었으며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되어 고품질 단백질 발현 분석에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041154-100 Anti-PTCD3 Antibody, pentatricopeptide repeat domain 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041154-25 Anti-PTCD3 Antibody, pentatricopeptide repeat domain 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTCD3 Antibody

Anti-PTCD3 Antibody

Target: pentatricopeptide repeat domain 3 (PTCD3)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Independent validation)
  • Immunocytochemistry (ICC)

Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against Human PTCD3

Alternative Gene Names: DKFZp666K071, FLJ20758
Target Protein: pentatricopeptide repeat domain 3
Target Gene: PTCD3
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

PATSLNCIAILFLRAGRTQEAWKMLGLFRKHNKIPRSELLNELMDSAKVSNSPSQAIEVVELASAFSLPICEGLTQRVMSDFAINQEQKEALSNLTAL

Open Datasheet


Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000009484 74%
Mouse ENSMUSG00000063884 68%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.