
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PTCD3 Antibody
상품 한눈에 보기
인간 PTCD3 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit에서 생산되었으며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되어 고품질 단백질 발현 분석에 활용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041154-100 Anti-PTCD3 Antibody, pentatricopeptide repeat domain 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041154-25 Anti-PTCD3 Antibody, pentatricopeptide repeat domain 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PTCD3 Antibody
Anti-PTCD3 Antibody
Target: pentatricopeptide repeat domain 3 (PTCD3)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Independent validation)
- Immunocytochemistry (ICC)
Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human PTCD3
Alternative Gene Names: DKFZp666K071, FLJ20758
Target Protein: pentatricopeptide repeat domain 3
Target Gene: PTCD3
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PATSLNCIAILFLRAGRTQEAWKMLGLFRKHNKIPRSELLNELMDSAKVSNSPSQAIEVVELASAFSLPICEGLTQRVMSDFAINQEQKEALSNLTAL
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000009484 | 74% |
| Mouse | ENSMUSG00000063884 | 68% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



