Atlas Antibodies Anti-PTCD1 Antibody

상품 한눈에 보기

Human PTCD1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Orthogonal validation을 통해 단백질 발현이 검증되었으며, PrEST 항원을 사용해 친화 정제되었습니다. 인간 대상, PTCD1 유전자 연구에 활용 가능합니다.

카탈로그번호: HPA047679-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA047679-100 Anti-PTCD1 Antibody, pentatricopeptide repeat domain 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA047679-25 Anti-PTCD1 Antibody, pentatricopeptide repeat domain 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PTCD1 Antibody

Anti-PTCD1 Antibody

Target: pentatricopeptide repeat domain 1 (PTCD1)
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB) – Orthogonal validation
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody against Human PTCD1.

Alternative Gene Names

KIAA0632

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	pentatricopeptide repeat domain 1
Target Gene	PTCD1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	PVELEVNLLTPGAVPPTVVSFGTVTTPADRLALIGGLEGFLSKMAEHRQQPDIRTLTLLAEVVESGSPAESLLLALLDEHQVEADLTFFNTLVRKKSKLGDLE
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000000987 (80%), Mouse ENSMUSG00000029624 (76%)