CacheBy
Atlas Antibodies Anti-PTCD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTCD1 Antibody

상품 한눈에 보기

Human PTCD1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Orthogonal validation을 통해 단백질 발현이 검증되었으며, PrEST 항원을 사용해 친화 정제되었습니다. 인간 대상, PTCD1 유전자 연구에 활용 가능합니다.

카탈로그번호
HPA047679-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047679-100 Anti-PTCD1 Antibody, pentatricopeptide repeat domain 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047679-25 Anti-PTCD1 Antibody, pentatricopeptide repeat domain 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTCD1 Antibody

Anti-PTCD1 Antibody

Target: pentatricopeptide repeat domain 1 (PTCD1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Orthogonal validation
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody against Human PTCD1.


Alternative Gene Names

  • KIAA0632

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein pentatricopeptide repeat domain 1
Target Gene PTCD1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PVELEVNLLTPGAVPPTVVSFGTVTTPADRLALIGGLEGFLSKMAEHRQQPDIRTLTLLAEVVESGSPAESLLLALLDEHQVEADLTFFNTLVRKKSKLGDLE
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000000987 (80%), Mouse ENSMUSG00000029624 (76%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.