CacheBy
Atlas Antibodies Anti-PTCD3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTCD3 Antibody

상품 한눈에 보기

인간 PTCD3 단백질을 인식하는 폴리클로날 항체로, IHC·WB·ICC 등 다양한 응용에 적합. 독립 항체 비교를 통한 단백질 발현 검증 완료. Rabbit 유래 IgG, PrEST 항원 기반 친화 정제. 휴먼 특이성 검증 및 높은 항원 서열 일치율.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA041382-100 Anti-PTCD3 Antibody, pentatricopeptide repeat domain 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041382-25 Anti-PTCD3 Antibody, pentatricopeptide repeat domain 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTCD3 Antibody

Anti-PTCD3 Antibody

Target: Pentatricopeptide Repeat Domain 3 (PTCD3)
Supplier: Atlas Antibodies

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Independent validation)
  • ICC (Immunocytochemistry)

Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against Human PTCD3

Alternative Gene Names

  • DKFZp666K071
  • FLJ20758

Open Datasheet

Target Information

항목 내용
Target Protein Pentatricopeptide repeat domain 3
Target Gene PTCD3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000009484 (74%), Mouse ENSMUSG00000063884 (68%)

Antigen Sequence:
PATSLNCIAILFLRAGRTQEAWKMLGLFRKHNKIPRSELLNELMDSAKVSNSPSQAIEVVELASAFSLPICEGLTQRVMSDFAINQEQKEALSNLTAL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.