CacheBy
Atlas Antibodies Anti-PTCD3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTCD3 Antibody

상품 한눈에 보기

인간 PTCD3 단백질을 인식하는 폴리클로날 항체로, IHC·WB·ICC 등 다양한 응용에 적합. 독립 항체 비교를 통한 단백질 발현 검증 완료. Rabbit 유래 IgG, PrEST 항원 기반 친화 정제. 휴먼 특이성 검증 및 높은 항원 서열 일치율.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041382-100 Anti-PTCD3 Antibody, pentatricopeptide repeat domain 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041382-25 Anti-PTCD3 Antibody, pentatricopeptide repeat domain 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTCD3 Antibody

Anti-PTCD3 Antibody

Target: Pentatricopeptide Repeat Domain 3 (PTCD3)
Supplier: Atlas Antibodies

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Independent validation)
  • ICC (Immunocytochemistry)

Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against Human PTCD3

Alternative Gene Names

  • DKFZp666K071
  • FLJ20758

Open Datasheet

Target Information

항목 내용
Target Protein Pentatricopeptide repeat domain 3
Target Gene PTCD3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000009484 (74%), Mouse ENSMUSG00000063884 (68%)

Antigen Sequence:
PATSLNCIAILFLRAGRTQEAWKMLGLFRKHNKIPRSELLNELMDSAKVSNSPSQAIEVVELASAFSLPICEGLTQRVMSDFAINQEQKEALSNLTAL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.