
Atlas Antibodies Anti-CRTAC1 Antibody
상품 한눈에 보기
인체 유래 CRTAC1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 검증 완료. RNA-seq 데이터 기반 직교 검증으로 높은 특이성 확보. PrEST 항원으로 친화 정제된 고품질 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CRTAC1 Antibody
Target: cartilage acidic protein 1 (CRTAC1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression.
- WB (Western Blot)
Product Description
Polyclonal antibody against human CRTAC1.
Alternative Gene Names
ASPIC1, CEP-68, FLJ10320
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Cartilage acidic protein 1 |
| Target Gene | CRTAC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAP |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Mouse Ortholog Identity | 94% (ENSMUSG00000042401) |
| Rat Ortholog Identity | 93% (ENSRNOG00000015220) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
