CacheBy
Atlas Antibodies Anti-CROT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CROT Antibody

상품 한눈에 보기

Human CROT 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증 완료. Rabbit 유래 IgG, PrEST 항원으로 친화 정제. 인간 반응성 확인, Rat 및 Mouse와 높은 서열 유사성. 안정한 PBS/glycerol buffer 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019364-100 Anti-CROT Antibody, carnitine O-octanoyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019364-25 Anti-CROT Antibody, carnitine O-octanoyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CROT Antibody

Anti-CROT Antibody

Target Information

  • Target Protein: Carnitine O-octanoyltransferase
  • Target Gene: CROT
  • Alternative Gene Name: COT

Product Description

Polyclonal antibody against human CROT.

  • Immunohistochemistry (IHC)
  • Western Blot (WB, Recombinant Expression)

Recombinant expression validation in WB using target protein overexpression.

Antigen Information

Antigen Sequence (PrEST antigen):

LAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWLEEWWLNVAYLDVRIPSQLNVNFAGPAAHFEHYWPPKEGTQLERGSITLWH

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000006779 89%
Mouse ENSMUSG00000003623 87%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.