CacheBy
Atlas Antibodies Anti-CRP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CRP Antibody

상품 한눈에 보기

Human CRP 단백질을 타깃으로 하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit에서 생산되었으며, PrEST 항원을 이용해 친화 정제되었습니다. 고순도 IgG 항체로 인간 시료에 높은 특이성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027367-100 Anti-CRP Antibody, C-reactive protein, pentraxin-related 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027367-25 Anti-CRP Antibody, C-reactive protein, pentraxin-related 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CRP Antibody

Anti-CRP Antibody

C-reactive protein, pentraxin-related

  • Immunohistochemistry (IHC)
  • Western Blot (WB, Independent Validation)

Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against human C-reactive protein (CRP).

Alternative Gene Names

  • PTX1

Open Datasheet


Target Information

항목 내용
Target Protein C-reactive protein, pentraxin-related
Target Gene CRP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGS
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000037942 (69%), Rat ENSRNOG00000000053 (57%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.