
원본
Atlas Antibodies Anti-CRB3 Antibody
상품 한눈에 보기
Human CRB3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Orthogonal 검증을 통해 단백질 발현을 RNA-seq 데이터와 비교하여 확인하였습니다. PrEST 항원을 이용해 친화정제되었으며, 인간에 대한 반응성이 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA013835-100 Anti-CRB3 Antibody, crumbs family member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013835-25 Anti-CRB3 Antibody, crumbs family member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CRB3 Antibody
Anti-CRB3 Antibody
Target: crumbs family member 3 (CRB3)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human CRB3.
Alternative Gene Names
- MGC17303
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | crumbs family member 3 |
| Target Gene | CRB3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSKETVQGCLPI |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000047322 | 91% |
| Mouse | ENSMUSG00000044279 | 91% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



