CacheBy
Atlas Antibodies Anti-CRB3 Antibody
원본

Atlas Antibodies Anti-CRB3 Antibody

상품 한눈에 보기

Human CRB3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Orthogonal 검증을 통해 단백질 발현을 RNA-seq 데이터와 비교하여 확인하였습니다. PrEST 항원을 이용해 친화정제되었으며, 인간에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA013835-100 Anti-CRB3 Antibody, crumbs family member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013835-25 Anti-CRB3 Antibody, crumbs family member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CRB3 Antibody

Anti-CRB3 Antibody

Target: crumbs family member 3 (CRB3)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human CRB3.


Alternative Gene Names

  • MGC17303

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein crumbs family member 3
Target Gene CRB3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSKETVQGCLPI

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000047322 91%
Mouse ENSMUSG00000044279 91%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.