CacheBy
Atlas Antibodies Anti-CRB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CRB1 Antibody

상품 한눈에 보기

Human CRB1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC와 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 시료는 40% glycerol/PBS buffer에 보존됩니다. 인간에 대한 반응성이 검증되었습니다.

카탈로그번호
HPA063127-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063127-100 Anti-CRB1 Antibody, crumbs family member 1, photoreceptor morphogenesis associated 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063127-25 Anti-CRB1 Antibody, crumbs family member 1, photoreceptor morphogenesis associated 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CRB1 Antibody

Anti-CRB1 Antibody

Target: crumbs family member 1, photoreceptor morphogenesis associated
Type: Polyclonal Antibody against Human CRB1


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody targeting human CRB1, also known as crumbs family member 1, photoreceptor morphogenesis associated.


Alternative Gene Names

  • LCA8
  • RP12

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein crumbs family member 1, photoreceptor morphogenesis associated
Target Gene CRB1
Verified Species Reactivity Human
Interspecies Homology Mouse (75%), Rat (68%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:

LLLALENSTYQYIRVWLERGRLAMLTPNSPKLVVKFVLNDGNVHLISLKIKPYKIELYQSSQNLGFISASTWKIEKGDV

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.