CacheBy
Atlas Antibodies Anti-CRBN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CRBN Antibody

상품 한눈에 보기

Human CRBN 단백질을 인식하는 토끼 다클론 항체로, IHC, WB, ICC에 적합합니다. siRNA knockdown으로 유전학적 검증 완료. 고순도 Affinity 정제 및 다양한 종(인간, 마우스, 랫드)에 반응합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045910-100 Anti-CRBN Antibody, cereblon 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045910-25 Anti-CRBN Antibody, cereblon 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CRBN Antibody

Anti-CRBN Antibody

Target Protein: cereblon
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot) — Genetic validation by siRNA knockdown
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human CRBN.


Alternative Gene Names

  • MRT2
  • MRT2A

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein cereblon
Target Gene CRBN
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence EVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQERE

Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000006534 (97%)
  • Mouse ENSMUSG00000005362 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.