
Atlas Antibodies Anti-CR2 Antibody
Human CR2(CD21)을 인식하는 rabbit polyclonal antibody로, IHC orthogonal validation을 통해 단백질 발현 검증됨. Recombinant PrEST 항원으로 정제되었으며, PBS/glycerol buffer에 보존. 다양한 조직에서 RNA-seq 데이터와 비교 검증된 신뢰성 높은 항체.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CR2 Antibody
Target: Complement component (3d/Epstein Barr virus) receptor 2 (CR2, CD21)
Type: Polyclonal Antibody against Human CR2
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody raised in rabbit against human CR2 (CD21).
Validated through orthogonal IHC and RNA-seq comparison.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Complement component (3d/Epstein Barr virus) receptor 2 |
| Target Gene | CR2 |
| Alternative Gene Names | CD21 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000034164 (65%), Mouse ENSMUSG00000026616 (64%) |
Antigen Sequence:
RLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVTYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANF
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
