Atlas Antibodies Anti-CR2 Antibody

상품 한눈에 보기

Human CR2(CD21)을 인식하는 rabbit polyclonal antibody로, IHC orthogonal validation을 통해 단백질 발현 검증됨. Recombinant PrEST 항원으로 정제되었으며, PBS/glycerol buffer에 보존. 다양한 조직에서 RNA-seq 데이터와 비교 검증된 신뢰성 높은 항체.

카탈로그번호: HPA052942-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA052942-100 Anti-CR2 Antibody, complement component (3d/Epstein Barr virus) receptor 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA052942-25 Anti-CR2 Antibody, complement component (3d/Epstein Barr virus) receptor 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CR2 Antibody

Anti-CR2 Antibody

Target: Complement component (3d/Epstein Barr virus) receptor 2 (CR2, CD21)
Type: Polyclonal Antibody against Human CR2
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody raised in rabbit against human CR2 (CD21).
Validated through orthogonal IHC and RNA-seq comparison.

Target Information

항목	내용
Target Protein	Complement component (3d/Epstein Barr virus) receptor 2
Target Gene	CR2
Alternative Gene Names	CD21
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000034164 (65%), Mouse ENSMUSG00000026616 (64%)

Antigen Sequence:
RLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVTYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANF

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet