Atlas Antibodies Anti-CR1 Antibody

상품 한눈에 보기

Human CR1 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC Orthogonal Validation을 통해 RNA-seq 데이터와 비교 검증됨. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에 반응하며 CD35, KN 대체 유전자명 포함.

카탈로그번호: HPA049348-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA049348-100 Anti-CR1 Antibody, complement component (3b/4b) receptor 1 (Knops blood group) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA049348-25 Anti-CR1 Antibody, complement component (3b/4b) receptor 1 (Knops blood group) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CR1 Antibody

Anti-CR1 Antibody

Target: Complement component (3b/4b) receptor 1 (Knops blood group)

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human CR1

Alternative Gene Names

CD35, KN

Open Datasheet

Target Information

항목	내용
Target Protein	Complement component (3b/4b) receptor 1 (Knops blood group)
Target Gene	CR1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000026616 (61%), Rat ENSRNOG00000008193 (58%)

Antigen Sequence:

LIGSPSTTCLVSGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFHNGTVVTYQCHTGPDGEQ

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand