CacheBy
Atlas Antibodies Anti-CRB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CRB1 Antibody

상품 한눈에 보기

인간 CRB1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. Rabbit에서 생산된 IgG 형식으로 고순도 Affinity 정제되었습니다. 시각수용체 형태형성 관련 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061250-100 Anti-CRB1 Antibody, crumbs family member 1, photoreceptor morphogenesis associated 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061250-25 Anti-CRB1 Antibody, crumbs family member 1, photoreceptor morphogenesis associated 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CRB1 Antibody

Anti-CRB1 Antibody

crumbs family member 1, photoreceptor morphogenesis associated


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human CRB1


Alternative Gene Names

  • LCA8
  • RP12

Open Datasheet


Target Information

항목 내용
Target Protein crumbs family member 1, photoreceptor morphogenesis associated
Target Gene CRB1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LLLALENSTYQYIRVWLERGRLAMLTPNSPKLVVKFVLNDGNVHLISLKIKPYKIELYQSSQNLGFISASTWKIEKGDV
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000063681 (75%), Rat ENSRNOG00000010903 (68%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.