
Atlas Antibodies Anti-COLGALT1 Antibody
상품 한눈에 보기
인체 COLGALT1 단백질에 대한 고품질 폴리클로날 항체. IHC 및 WB 응용에 적합. Rabbit에서 생산된 IgG 형식으로 높은 특이성과 재현성 제공. Affinity purification을 통해 높은 순도 확보. Human에 검증된 반응성.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-COLGALT1 Antibody
Target Protein: collagen beta(1-O)galactosyltransferase 1
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human COLGALT1.
Alternative Gene Names
FLJ22329, GLT25D1
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
FAFSCKQAEVQMYVCNKEEYGFLPVPLRAHSTLQDEAESFMHVQLEVMVKHPPAEPSRFISAPTKTPD
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000034807 | 90% |
| Rat | ENSRNOG00000023317 | 88% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet (MSDS)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-COMMD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COLQ Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COLGALT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COLGALT2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COMMD1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.