원본

Atlas Antibodies Anti-COLQ Antibody

상품 한눈에 보기

Human COLQ 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, 면역세포화학(ICC) 등 다양한 연구 응용에 적합. PrEST 항원을 이용해 친화정제되었으며, Human에 대한 반응성이 검증됨. 안정한 PBS/glycerol buffer로 보관 용이.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA045876-100 Anti-COLQ Antibody, collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA045876-25 Anti-COLQ Antibody, collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-COLQ Antibody

Anti-COLQ Antibody

Target: collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase

Recommended Applications

면역세포화학 (ICC) 등 다양한 연구용 응용에 적합

Product Description

Polyclonal Antibody against Human COLQ

Alternative Gene Names

EAD

Open Datasheet (PDF)

Target Information

Target Protein: collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase
Target Gene: COLQ
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

PPGRCLCGPTMNVNNPSYGESVYGPSSPRVPVIFVVNNQEELERLNTQNAIAFRRDQRSLYFKDSLGWLPIQLTPFYPVDYTA

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000057606 (89%)
Rat ENSRNOG00000019615 (84%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand