CacheBy
Atlas Antibodies Anti-COLQ Antibody
원본

Atlas Antibodies Anti-COLQ Antibody

상품 한눈에 보기

Human COLQ 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, 면역세포화학(ICC) 등 다양한 연구 응용에 적합. PrEST 항원을 이용해 친화정제되었으며, Human에 대한 반응성이 검증됨. 안정한 PBS/glycerol buffer로 보관 용이.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045876-100 Anti-COLQ Antibody, collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045876-25 Anti-COLQ Antibody, collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COLQ Antibody

Anti-COLQ Antibody

Target: collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase

면역세포화학 (ICC) 등 다양한 연구용 응용에 적합

Product Description

Polyclonal Antibody against Human COLQ

Alternative Gene Names

EAD

Open Datasheet (PDF)

Target Information

  • Target Protein: collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase
  • Target Gene: COLQ
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PPGRCLCGPTMNVNNPSYGESVYGPSSPRVPVIFVVNNQEELERLNTQNAIAFRRDQRSLYFKDSLGWLPIQLTPFYPVDYTA

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000057606 (89%)
  • Rat ENSRNOG00000019615 (84%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.