CacheBy
Atlas Antibodies Anti-COLGALT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COLGALT2 Antibody

상품 한눈에 보기

Human COLGALT2 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 정제되었으며, 사람, 마우스, 랫트 반응성이 검증되었습니다. 고품질 단백질 발현 검증용으로 이상적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031749-100 Anti-COLGALT2 Antibody, collagen beta(1-O)galactosyltransferase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031749-25 Anti-COLGALT2 Antibody, collagen beta(1-O)galactosyltransferase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COLGALT2 Antibody

Anti-COLGALT2 Antibody

Target: collagen beta(1-O)galactosyltransferase 2 (COLGALT2)
Type: Polyclonal Antibody against Human COLGALT2


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Independent validation)
    • Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human COLGALT2.


Alternative Gene Names

C1orf17, GLT25D2, KIAA0584

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein collagen beta(1-O)galactosyltransferase 2
Target Gene COLGALT2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
AFSSRQAGIQMYLCNREHYGYLPIPLKPHQTLQEDIENLIHVQIEAMIDRPPMEPSQYVSVVPKYPDKMGFDEI
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000028207 (96%)
Mouse ENSMUSG00000032649 (95%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.