
Atlas Antibodies Anti-COL28A1 Antibody
상품 한눈에 보기
Human COL28A1 단백질을 인식하는 rabbit polyclonal 항체로, PrEST 항원을 이용해 정제됨. 면역형광 등 다양한 응용에 적합하며, 40% glycerol과 PBS 완충액에 보존됨. 인체 반응성이 검증된 고품질 연구용 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-COL28A1 Antibody
Target: Collagen type XXVIII alpha 1 chain (COL28A1)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human COL28A1.
Affinity purified using the PrEST antigen as affinity ligand.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Collagen type XXVIII alpha 1 chain |
| Target Gene | COL28A1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000033618 (58%), Mouse ENSMUSG00000068794 (57%) |
Antigen Sequence
SESLSVTRDQDEDDKAPEPTWADDLPATTSSEATTTPRPLLSTPVDGAEDPRCLEALKPGNCGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQETBuffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-COL28A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COL27A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COL28A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COL26A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COL21A1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.