CacheBy
Atlas Antibodies Anti-COL28A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COL28A1 Antibody

상품 한눈에 보기

Human COL28A1 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학 등 다양한 연구용으로 사용 가능. PrEST 항원으로 정제되었으며, 고순도 IgG 포맷. PBS와 글리세롤 버퍼에 보존되어 안정적 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA060468-100 Anti-COL28A1 Antibody, collagen, type XXVIII, alpha 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060468-25 Anti-COL28A1 Antibody, collagen, type XXVIII, alpha 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COL28A1 Antibody

Anti-COL28A1 Antibody

Target: Collagen type XXVIII alpha 1 chain
Supplier: Atlas Antibodies
Catalog No.: HPA043844


Product Description

Polyclonal antibody against human COL28A1 (collagen type XXVIII alpha 1 chain).
Produced in rabbit and affinity purified using the PrEST antigen as ligand.

Open Datasheet (PDF)


  • Immunocytochemistry (ICC)

Target Information

항목 내용
Target Protein Collagen type XXVIII alpha 1 chain
Target Gene COL28A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SESLSVTRDQDEDDKAPEPTWADDLPATTSSEATTTPRPLLSTPVDGAEDPRCLEALKPGNCGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQET
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000033618 (58%), Mouse ENSMUSG00000068794 (57%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Application: ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.