
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-COL28A1 Antibody
상품 한눈에 보기
Human COL28A1 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학 등 다양한 연구용으로 사용 가능. PrEST 항원으로 정제되었으며, 고순도 IgG 포맷. PBS와 글리세롤 버퍼에 보존되어 안정적 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA060468-100 Anti-COL28A1 Antibody, collagen, type XXVIII, alpha 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060468-25 Anti-COL28A1 Antibody, collagen, type XXVIII, alpha 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-COL28A1 Antibody
Anti-COL28A1 Antibody
Target: Collagen type XXVIII alpha 1 chain
Supplier: Atlas Antibodies
Catalog No.: HPA043844
Product Description
Polyclonal antibody against human COL28A1 (collagen type XXVIII alpha 1 chain).
Produced in rabbit and affinity purified using the PrEST antigen as ligand.
Recommended Applications
- Immunocytochemistry (ICC)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Collagen type XXVIII alpha 1 chain |
| Target Gene | COL28A1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SESLSVTRDQDEDDKAPEPTWADDLPATTSSEATTTPRPLLSTPVDGAEDPRCLEALKPGNCGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQET |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000033618 (58%), Mouse ENSMUSG00000068794 (57%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | PBS (pH 7.2) |
| Additives | 40% glycerol, 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



