CacheBy
Atlas Antibodies Anti-COL26A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COL26A1 Antibody

상품 한눈에 보기

Human COL26A1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합. PrEST 항원으로 친화 정제됨. 높은 종 간 서열 동일성으로 인간, 마우스, 랫트 반응 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027059-100 Anti-COL26A1 Antibody, collagen, type XXVI, alpha 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027059-25 Anti-COL26A1 Antibody, collagen, type XXVI, alpha 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COL26A1 Antibody

Anti-COL26A1 Antibody

Target Information

  • Target Protein: Collagen, type XXVI, alpha 1
  • Target Gene: COL26A1
  • Alternative Gene Names: EMI6, EMID2, Emu2

Product Description

Polyclonal antibody against human COL26A1.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ANLVSYRTLIRPTYRVSYRTVTVLEWRCCPGFTGSNCDEECMNCTRLSDMSERLTTLEAKVLLLEAAERPSSPDNDLPAPESTPPTWNEDFLPDAIPLAHPVP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000004415 (92%)
  • Rat ENSRNOG00000001422 (75%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.