Thermo Fisher Scientific PARVA Polyclonal Antibody
PARVA 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC(P) 실험에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 정제 방식으로 제조되었으며, 동결건조 형태로 제공. 연구용으로만 사용.
- 카탈로그번호
- PA579784
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific PARVA Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Parvin alpha (155–185aa, QKLQTVLEKINETLKLPPRSIKWNVDSVHAK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746899 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The protein encoded by this gene is a transcription factor that contains C2H2-type zinc-fingers. It also includes a positive regulatory domain found in several other zinc-finger transcription factors involved in B cell differentiation and tumor suppression. Studies of the mouse counterpart suggest that this protein may play roles in the development of the central nervous system (CNS) and in the pathogenesis of neuronal storage disease. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.