CacheBy
Thermo Fisher Scientific PARVA Polyclonal Antibody
원본

Thermo Fisher Scientific PARVA Polyclonal Antibody

상품 한눈에 보기

PARVA 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC(P) 실험에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 정제 방식으로 제조되었으며, 동결건조 형태로 제공. 연구용으로만 사용.

카탈로그번호
PA579784
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 03:09
Thermo Fisher Scientific PA579784 PARVA Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific PARVA Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human Parvin alpha (155–185aa, QKLQTVLEKINETLKLPPRSIKWNVDSVHAK)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage conditions -20°C
Shipping conditions Ambient (domestic); Wet ice (international)
RRID AB_2746899

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

The protein encoded by this gene is a transcription factor that contains C2H2-type zinc-fingers. It also includes a positive regulatory domain found in several other zinc-finger transcription factors involved in B cell differentiation and tumor suppression. Studies of the mouse counterpart suggest that this protein may play roles in the development of the central nervous system (CNS) and in the pathogenesis of neuronal storage disease. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.