Thermo Fisher Scientific PARVA Polyclonal Antibody
PARVA 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC(P) 실험에 사용 가능. Human, Mouse, Rat 반응성. 항원 친화 정제 방식으로 제조되었으며, 동결건조 형태로 제공. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Parvin alpha (155–185aa, QKLQTVLEKINETLKLPPRSIKWNVDSVHAK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746899 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The protein encoded by this gene is a transcription factor that contains C2H2-type zinc-fingers. It also includes a positive regulatory domain found in several other zinc-finger transcription factors involved in B cell differentiation and tumor suppression. Studies of the mouse counterpart suggest that this protein may play roles in the development of the central nervous system (CNS) and in the pathogenesis of neuronal storage disease. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific PAK3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PARN Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PARVA Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PAH Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific EBP1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|