
원본
Thermo Fisher Scientific E2F4 Polyclonal Antibody
상품 한눈에 보기
E2F4 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. WB 및 IHC(P)에서 검증됨. 항원 친화 크로마토그래피로 정제되어 높은 특이성과 재현성을 제공. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 07:52
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579182 E2F4 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific E2F4 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
- Publications: References
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
- Publications: References
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse, Rat, Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human E2F4 (106–144aa ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746298 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
E2F transcription factors are functionally regulated by binding to Rb p110, p107, and p130.
E2F-4 is regulated by complex formation with Rb p110.
E2F family members bind DNA as heterodimers with members of the DP family of polypeptides.
Differential phosphorylation contributes to the microheterogeneity of E2F-4 (total aa 411–416, varies due to a trinucleotide repeat).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
