CacheBy
Thermo Fisher Scientific E2F4 Polyclonal Antibody
원본

Thermo Fisher Scientific E2F4 Polyclonal Antibody

상품 한눈에 보기

E2F4 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. WB 및 IHC(P)에서 검증됨. 항원 친화 크로마토그래피로 정제되어 높은 특이성과 재현성을 제공. 연구용으로만 사용 가능.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 07:52
Thermo Fisher Scientific PA579182 E2F4 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific E2F4 Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.1–0.5 µg/mL
  • Publications: References

Immunohistochemistry (Paraffin) (IHC (P))

  • Tested Dilution: 0.5–1 µg/mL
  • Publications: References

Product Specifications

항목 내용
Species Reactivity Mouse, Rat, Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human E2F4 (106–144aa ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage conditions -20°C
Shipping conditions Ambient (domestic); Wet ice (international)
RRID AB_2746298

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.


Target Information

E2F transcription factors are functionally regulated by binding to Rb p110, p107, and p130.
E2F-4 is regulated by complex formation with Rb p110.
E2F family members bind DNA as heterodimers with members of the DP family of polypeptides.
Differential phosphorylation contributes to the microheterogeneity of E2F-4 (total aa 411–416, varies due to a trinucleotide repeat).


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.