Thermo Fisher Scientific E2F4 Polyclonal Antibody
E2F4 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. WB 및 IHC(P)에서 검증됨. 항원 친화 크로마토그래피로 정제되어 높은 특이성과 재현성을 제공. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
- Publications: References
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
- Publications: References
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse, Rat, Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human E2F4 (106–144aa ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746298 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
E2F transcription factors are functionally regulated by binding to Rb p110, p107, and p130.
E2F-4 is regulated by complex formation with Rb p110.
E2F family members bind DNA as heterodimers with members of the DP family of polypeptides.
Differential phosphorylation contributes to the microheterogeneity of E2F-4 (total aa 411–416, varies due to a trinucleotide repeat).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific DCI Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific E2F3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific E2F4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific EGF Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific E2F2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|