Thermo Fisher Scientific CDC25C Polyclonal Antibody
Rabbit polyclonal antibody against human CDC25C. Validated for Western blot at 0.1–0.5 µg/mL. Lyophilized form, reconstitutable to 500 µg/mL. Affinity purified, supplied in PBS with BSA and sodium azide. For research use only.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Cdc25C (435–473 aa: MHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746133 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
M-phase inducer phosphatase 3 is an enzyme encoded by the CDC25C gene in humans.
This gene is highly conserved and plays a key role in regulating cell division.
The encoded protein is a tyrosine phosphatase belonging to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 (CDK1), triggering entry into mitosis, and may suppress p53-induced growth arrest.
Multiple alternatively spliced transcript variants have been described, though the full-length nature of many remains unknown.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific CDC6 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CDC37 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CDC25C Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CDC20 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CDC25B Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|