Thermo Fisher Scientific CDC25C Polyclonal Antibody
Rabbit polyclonal antibody against human CDC25C. Validated for Western blot at 0.1–0.5 µg/mL. Lyophilized form, reconstitutable to 500 µg/mL. Affinity purified, supplied in PBS with BSA and sodium azide. For research use only.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific CDC25C Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Cdc25C (435–473 aa: MHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746133 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
M-phase inducer phosphatase 3 is an enzyme encoded by the CDC25C gene in humans.
This gene is highly conserved and plays a key role in regulating cell division.
The encoded protein is a tyrosine phosphatase belonging to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 (CDK1), triggering entry into mitosis, and may suppress p53-induced growth arrest.
Multiple alternatively spliced transcript variants have been described, though the full-length nature of many remains unknown.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.