Thermo Fisher Scientific CDC20 Polyclonal Antibody
Thermo Fisher Scientific의 CDC20 폴리클로날 항체는 인간, 마우스, 랫트 시료에 반응하며 다양한 응용 분야(WB, IHC, ICC, Flow)에 사용 가능. 항원 친화 크로마토그래피로 정제된 고순도 항체로, 세포주기 조절 연구에 적합. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific CDC20 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence of human Cdc20 (QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKAT) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746129 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
CDC20 is required for full ubiquitin ligase activity of the anaphase-promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. It is regulated by MAD2L1: in metaphase, the MAD2L1-CDC20-APC/C ternary complex is inactive, and in anaphase, the CDC20-APC/C binary complex becomes active in degrading substrates. The CDC20-APC/C complex positively regulates synaptic vesicle clustering at active zones in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 promotes presynaptic differentiation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.