Thermo Fisher Scientific CDC20 Polyclonal Antibody
Thermo Fisher Scientific의 CDC20 폴리클로날 항체는 인간, 마우스, 랫트 시료에 반응하며 다양한 응용 분야(WB, IHC, ICC, Flow)에 사용 가능. 항원 친화 크로마토그래피로 정제된 고순도 항체로, 세포주기 조절 연구에 적합. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence of human Cdc20 (QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKAT) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746129 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
CDC20 is required for full ubiquitin ligase activity of the anaphase-promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. It is regulated by MAD2L1: in metaphase, the MAD2L1-CDC20-APC/C ternary complex is inactive, and in anaphase, the CDC20-APC/C binary complex becomes active in degrading substrates. The CDC20-APC/C complex positively regulates synaptic vesicle clustering at active zones in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 promotes presynaptic differentiation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific CDC37 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CDC25C Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CDC20 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CDC25B Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CD86 Polyclonal Antibody
668,200원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|