Thermo Fisher Scientific MEK3 Polyclonal Antibody
MEK3 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, Western blot, IHC, ICC, Flow Cytometry에 적합합니다. 인간, 마우스, 랫트 반응성을 가지며 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 -20°C 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.25–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human MEK3 (311–347aa: AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746741 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
MAP2K3 (MEK3) is a dual-specificity protein kinase involved in cellular signal transduction pathways and is necessary for the expression of glucose transporter. It phosphorylates and activates MAPK14/p38-MAPK. MEK3 can be activated by insulin and RAS oncogene expression, leading to constitutive MAPK14 activation and oncogenic transformation of primary cells. Inhibition of this kinase is implicated in the pathogenesis of Yersinia pseudotuberculosis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported for MEK3.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific MKK7 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MAP2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MEK3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MKK7 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MAOB Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|