Thermo Fisher Scientific MEK3 Polyclonal Antibody
MEK3 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, Western blot, IHC, ICC, Flow Cytometry에 적합합니다. 인간, 마우스, 랫트 반응성을 가지며 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 -20°C 보관합니다.
- 카탈로그번호
- PA579626
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific MEK3 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.25–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human MEK3 (311–347aa: AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746741 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
MAP2K3 (MEK3) is a dual-specificity protein kinase involved in cellular signal transduction pathways and is necessary for the expression of glucose transporter. It phosphorylates and activates MAPK14/p38-MAPK. MEK3 can be activated by insulin and RAS oncogene expression, leading to constitutive MAPK14 activation and oncogenic transformation of primary cells. Inhibition of this kinase is implicated in the pathogenesis of Yersinia pseudotuberculosis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported for MEK3.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.