Thermo Fisher Scientific MAOB Polyclonal Antibody
MAOB 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, IHC, ICC/IF에 적합하며 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 고품질 항체로, 신경전달물질 대사 연구에 활용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific MAOB Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human MAOB (C-terminus, 448–484aa: REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746739 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
MAOB (Monoamine Oxidase B), also known as MAO, BRAIN, AMINE OXIDASE (FLAVIN-CONTAINING) B, is encoded by the MAOB gene located on Xp11.3.
MAOB is a flavin monoamine oxidase that catalyzes the oxidative deamination of biogenic and xenobiotic amines.
It plays a crucial role in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues.
- Preferentially degrades benzylamine and phenylethylamine
- Also degrades dopamine
- MAO-B inhibition enhances dopamine activity and reduces hydrogen peroxide production, lowering reactive oxygen species levels
Usage Notes
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific MEK3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MKK7 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MAOB Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MAOA Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific MAG Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|