Thermo Fisher Scientific MAOB Polyclonal Antibody
MAOB 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, IHC, ICC/IF에 적합하며 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 고품질 항체로, 신경전달물질 대사 연구에 활용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific MAOB Polyclonal Antibody
Thermo Fisher Scientific MAOB Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human MAOB (C-terminus, 448–484aa: REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746739 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
MAOB (Monoamine Oxidase B), also known as MAO, BRAIN, AMINE OXIDASE (FLAVIN-CONTAINING) B, is encoded by the MAOB gene located on Xp11.3.
MAOB is a flavin monoamine oxidase that catalyzes the oxidative deamination of biogenic and xenobiotic amines.
It plays a crucial role in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues.
- Preferentially degrades benzylamine and phenylethylamine
- Also degrades dopamine
- MAO-B inhibition enhances dopamine activity and reduces hydrogen peroxide production, lowering reactive oxygen species levels
Usage Notes
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.