
Thermo Fisher Scientific CTR1 Polyclonal Antibody
CTR1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, Western blot에 최적화되어 있습니다. 인간, 마우스, 랫트에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 구리 항상성 연구용으로 적합한 연구 전용 시약입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific CTR1 Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human SLC31A1/CTR1 (NGTILMETHKTVGQQMLSFPHLLQTVLHIIQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Wet ice |
| RRID | AB_2747144 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The trace metal copper (Cu) plays a crucial role in mammalian cells as a cofactor for many enzymes. Cu-related genetic diseases, such as Menkes disease and Wilson disease, arise from a lack of Cu homeostasis in mammalian cells. CTR1 is a high-affinity copper-uptake protein. The C-terminal domain is similar to the Raf family of protein kinases, but its first two-thirds encodes a novel protein domain. CTR1 provides the primary avenue for copper uptake in mammalian cells, thereby affecting Cu homeostasis and embryonic development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific SLC6A4 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Band 3 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific CTR1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific SLC30A4 Polyclonal Antibody

Thermo Fisher Scientific
Thermo Fisher Scientific GLUT9 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|