Thermo Fisher Scientific E2F1 Polyclonal Antibody, Biotin
E2F1 단백질을 인식하는 Biotin-conjugated Rabbit Polyclonal 항체로, Western blot, ELISA, Immunoprecipitation에 적합합니다. 인간, 마우스, 랫트 시료에 반응하며, 고순도의 Affinity chromatography로 정제되었습니다. 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| ELISA | 1:10,000 |
| Immunoprecipitation (IP) | 1:50–1:250 |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to amino acids 58–93 of Human E2F1. Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD |
| Conjugate | Biotin |
| Form | Liquid |
| Concentration | 0.5–1.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | Proprietary buffer, pH 7.4–7.8, with 0.5% BSA, 30% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Target Information
The protein encoded by this gene belongs to the E2F family of transcription factors, which play a crucial role in cell cycle control and tumor suppressor protein regulation. E2F proteins contain conserved domains such as:
- DNA binding domain
- Dimerization domain for interaction with DP proteins
- Transactivation domain enriched in acidic amino acids
- Tumor suppressor protein association domain
E2F1, along with E2F2 and E2F3, possesses an additional cyclin binding domain and binds preferentially to retinoblastoma protein (pRB) in a cell cycle–dependent manner. It can mediate both cell proliferation and p53-dependent/independent apoptosis.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific E2F1 Polyclonal Antibody, Biotin
594,400원
Thermo Fisher Scientific
Thermo Fisher Scientific E2F1 Polyclonal Antibody, FITC
594,400원
Thermo Fisher Scientific
Thermo Fisher Scientific E2F1 Polyclonal Antibody, Biotin
594,400원
Thermo Fisher Scientific
Thermo Fisher Scientific E2F1 Polyclonal Antibody
499,600원
Thermo Fisher Scientific
Thermo Fisher Scientific E2F1 Polyclonal Antibody, FITC
594,400원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|