Thermo Fisher Scientific E2F1 Polyclonal Antibody, Biotin
E2F1 단백질을 인식하는 Biotin-conjugated Rabbit Polyclonal 항체로, Western blot, ELISA, Immunoprecipitation에 적합합니다. 인간, 마우스, 랫트 시료에 반응하며, 고순도의 Affinity chromatography로 정제되었습니다. 연구용으로만 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific E2F1 Polyclonal Antibody, Biotin
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| ELISA | 1:10,000 |
| Immunoprecipitation (IP) | 1:50–1:250 |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to amino acids 58–93 of Human E2F1. Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD |
| Conjugate | Biotin |
| Form | Liquid |
| Concentration | 0.5–1.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | Proprietary buffer, pH 7.4–7.8, with 0.5% BSA, 30% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Target Information
The protein encoded by this gene belongs to the E2F family of transcription factors, which play a crucial role in cell cycle control and tumor suppressor protein regulation. E2F proteins contain conserved domains such as:
- DNA binding domain
- Dimerization domain for interaction with DP proteins
- Transactivation domain enriched in acidic amino acids
- Tumor suppressor protein association domain
E2F1, along with E2F2 and E2F3, possesses an additional cyclin binding domain and binds preferentially to retinoblastoma protein (pRB) in a cell cycle–dependent manner. It can mediate both cell proliferation and p53-dependent/independent apoptosis.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.